PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010559161.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 669aa    MW: 72981.5 Da    PI: 6.7103
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010559161.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.7e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE++++++a k++G   W +I  ++g ++t+ q++s+ qk+
   XP_010559161.1 24 RERWTEEEHDRFLEALKLYGRA-WQKIEDHVG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.64E-171874IPR009057Homeodomain-like
PROSITE profilePS5129421.3621973IPR017930Myb domain
TIGRFAMsTIGR015572.0E-172271IPR006447Myb domain, plants
SMARTSM007172.3E-132371IPR001005SANT/Myb domain
PfamPF002491.1E-132467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-92464IPR009057Homeodomain-like
CDDcd001671.01E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 669 aa     Download sequence    Send to blast
METNSSGEEL VIKMRKPYTI TKQRERWTEE EHDRFLEALK LYGRAWQKIE DHVGTKTAVQ  60
IRSHAQKFFS KVEKEAKAKG VPVGIALNID IPPPRPKKKP SNPYPRKTGN RTPTSQAAAQ  120
YPSEELLPSN LEDDHSASSM NKSSVETMAF ANGCSFTEFL PPRKEANQDN GTRKASNSEK  180
DCCDLHAKSV QGSAKKYVSG ISHVDEEQGP QTYTRHVPVH TIDGSSVASP ISPFPTVSEG  240
IHVCLNKFTD MSACANRSKH DNDGPRYKSR ALPAVHLASA PIPHTLDDYW SFANLFVSNP  300
LQNPAAHAAS TFAASVWPGG TSTCAEIGVP PSQVSSPSSL AAIAAATVSA ATAWWAAHGL  360
LPLCAPIHSA FPCHPPPTTL APISDDNGHA PYANVDTKES TLQNPSVQSQ DADPEHSEAS  420
KAQSSPLKTT LSPSYSEQSG STKTETGGKP ASHEQTEAET DQNRAKNRKQ VDRSSCGSNT  480
PSSSDAEVDA SEKLEKDKDE EKEVEVDVNP PAEESNIRRS RSSSNLSDPW KSVSDEVLGQ  540
GRLAFQALFS REVLPQSFPP RRDSKDKKDL RGNEDGEKKK SAETEHGEGQ ELDLNRTAQA  600
TDSDHQEEKG DQDGYLAIGL GASKLKERTG FKPYKRCSVD AKENRITNSS TLNRVEQKDP  660
KRICLERRA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010559161.10.0PREDICTED: protein CCA1-like isoform X4
SwissprotP929731e-155CCA1_ARATH; Protein CCA1
TrEMBLA0A0N7DST11e-160A0A0N7DST1_ARALP; CCA1 protein
TrEMBLA0A076L4N21e-160A0A076L4N2_9R
STRINGscaffold_403655.11e-157(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46830.11e-131circadian clock associated 1